PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00048330-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 370aa    MW: 41337.3 Da    PI: 4.2801
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00048330-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.2e-131052145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      rg+++ +E+  ++++   lG++ W+ Ia +m+ gRt++++k++w+
  PSME_00048330-RA 10 RGAFSCQEERFIIRLQSILGNR-WSQIAGHMP-GRTDNEIKNYWN 52
                      899999****************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-22159IPR009057Homeodomain-like
SuperFamilySSF466892.32E-13160IPR009057Homeodomain-like
PROSITE profilePS5129422.694559IPR017930Myb domain
SMARTSM007171.5E-12957IPR001005SANT/Myb domain
PfamPF002491.0E-111053IPR001005SANT/Myb domain
CDDcd001671.84E-91652No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MNYLRPELKR GAFSCQEERF IIRLQSILGN RWSQIAGHMP GRTDNEIKNY WNSSIKKKLL  60
LKNDGLSFSP NSNGSDESNI LPVQADLISN NDTNSVSIYD TFSSSHSGQP FLDIMRPEGY  120
QPANNTFNVV ANGENRLSVN PEVLKLENRQ VQDLNDEIST SDPDTNELIS YFQLWVDATS  180
THQRQTPNET PASGDYSSTV STSMTVPADN FIDSRQSFVK EFDNHGDMLV NENEITIDAS  240
SGLSRWSASY SYSDATDCSH VIYPGAYTPD YDREISIIED YQKTTPQSCA TLNSGSQFCA  300
PAGVTSSAGQ CNDFLAEDDC NDPLKLRYDV SLGISMHDID INTMQRSHSM EEEGLAIDGI  360
YQEFPIKKRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1625951108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.14e-24myb domain protein 46